PDB entry 2mst

View 2mst on RCSB PDB site
Description: musashi1 rbd2, nmr
Deposited on 1999-05-19, released 2000-05-19
The last revision prior to the SCOP 1.61 freeze date was dated 2000-05-19, with a file datestamp of 2000-05-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d2msta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mstA (A:)
    kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
    hfheinnkmveckka