PDB entry 2mss

View 2mss on RCSB PDB site
Description: musashi1 rbd2, nmr
Deposited on 1999-05-19, released 2000-05-19
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-19, with a file datestamp of 2000-05-19.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2mssa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mssA (A:)
kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
hfheinnkmveckka