PDB entry 2mss

View 2mss on RCSB PDB site
Description: musashi1 rbd2, nmr
Class: RNA binding protein
Keywords: RNA-binding domain, RNA binding protein
Deposited on 1999-05-19, released 2000-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (musashi1)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61474 (0-74)
  Domains in SCOPe 2.08: d2mssa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mssA (A:)
  kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
  hfheinnkmveckka