PDB entry 2mqp

View 2mqp on RCSB PDB site
Description: Structural Investigation of hnRNP L bound to RNA
Class: RNA binding protein/RNA
Keywords: Protein-RNA Complex, RRM, RNA BINDING PROTEIN-RNA complex
Deposited on 2014-06-24, released 2015-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Hnrnpl
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Hnrnpl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mqpa_
  • Chain 'B':
    Compound: RNA (5'-r(*ap*cp*ap*cp*ap*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mqpA (A:)
qkisrpgdsddsrsvnsvllftilnpiysittdvlyticnpcgpvqrivifrkngvqamv
efdsvqsaqrakaslngadiysgcctlkieyakptrlnvfkndqdtwdytnpnlsgqg

  • Chain 'B':
    No sequence available.