PDB entry 2mqj

View 2mqj on RCSB PDB site
Description: Solution structure of ubiquitin-like protein from Caldiarchaeum subterraneum
Class: ligase
Keywords: Caldiarchaeum subterraneum, LIGASE
Deposited on 2014-06-22, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein
    Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
    Gene: CSUB_C1474, HGMM_F04B03C03, HGMM_F21D07C21, HGMM_F30C12C33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mqja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mqjA (A:)
    hmkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykgralkdtetle
    slgvadgdkfvlitrtvggcgepirraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mqjA (A:)
    mkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykgralkdtetles
    lgvadgdkfvlitrtvg