PDB entry 2mpf

View 2mpf on RCSB PDB site
Description: Solution structure human HCN2 CNBD in the cAMP-unbound state
Class: transport protein
Keywords: HCN channels, TRANSPORT PROTEIN
Deposited on 2014-05-16, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN2, BCNG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mpfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mpfA (A:)
    gpsspmelngplreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiire
    gtigkkmyfiqhgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlysls
    vdnfnevleeypmmrrafetvaidrldrigkknsillh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mpfA (A:)
    ncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvsvlt
    kgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrrafe
    tvaidrldrigkknsillh