PDB entry 2mpa

View 2mpa on RCSB PDB site
Description: bactericidal antibody against neisseria meningitidis
Deposited on 1999-06-09, released 1999-06-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-23, with a file datestamp of 1999-06-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mpaH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mpaL (L:)
    divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec