PDB entry 2mox

View 2mox on RCSB PDB site
Description: solution structure of tandem SH3 domain of Sorbin and SH3 domain-containing protein 1
Class: signaling protein
Keywords: focal adhesion, SIGNALING PROTEIN
Deposited on 2014-05-07, released 2014-05-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sorbin and SH3 domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SORBS1, KIAA0894, KIAA1296, SH3D5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BX66 (3-142)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2moxa1, d2moxa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2moxA (A:)
  qhmsgsemrparakfdfkaqtlkelplqkgdivyiykqidqnwyegehhgrvgifprtyi
  ellppaekaqpkkltpvqvleygeaiakfnfngdtqvemsfrkgeritllrqvdenwyeg
  ripgtsrqgifpityvdvikrpl