PDB entry 2mou

View 2mou on RCSB PDB site
Description: Solution structure of StAR-related lipid transfer domain protein 6 (STARD6)
Class: transport protein
Keywords: Steroidogenic acute regulatory protein (StAR), START domain, Cholesterol metabolism, Steroidogenesis, TRANSPORT PROTEIN
Deposited on 2014-05-05, released 2014-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: StAR-related lipid transfer protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: NM_139171/NP_631910, STARD6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2moua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mouA (A:)
    mdfkaiaqqtaqevlgynrdtsgwkvvktskkitvsskasrkfhgnlyrvegiipespak
    lsdflyqtgdritwdkslqvynmvhridsdtfichtitqsfavgsisprdfidlvyikry
    egnmniissksvdfpeyppssnyirgynhpcgfvcspmeenpaysklvmfvqtemrgkls
    psiiektmpsnlvnfilnakdgikahrtpsrrgfhhnshs