PDB entry 2mmy

View 2mmy on RCSB PDB site
Description: Solution structure of the RNA recognition motif of human TAF15
Class: RNA binding protein
Keywords: TAF15, RRM, RNA binding protein
Deposited on 2014-03-22, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TATA-binding protein-associated factor 2N
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92804 (4-96)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2mmya1, d2mmya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mmyA (A:)
gshmsdnntifvqglgegvstdqvgeffkqigiiktnkktgkpminlytdkdtgkpkgea
tvsfddppsakaaidwfdgkefhgniikvsfatrrpe