PDB entry 2mlf

View 2mlf on RCSB PDB site
Description: NMR structure of the dilated cardiomyopathy mutation G159D in troponin C bound to the anchoring region of troponin I
Class: metal binding protein
Keywords: troponin C, metal binding protein, dilated cardiomyopathy, G159D, EF-hand
Deposited on 2014-02-26, released 2014-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (1-71)
      • initiating methionine (0)
      • engineered mutation (69)
    Domains in SCOPe 2.06: d2mlfc_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mlfC (C:)
mgkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgrid
ydeflefmkdve