PDB entry 2mks

View 2mks on RCSB PDB site
Description: NMR structure of the RRM domain of RBMX from homo sapiens
Class: RNA binding protein
Keywords: T-Cell, PSI-Biology, RNA binding protein
Deposited on 2014-02-14, released 2014-03-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding motif protein, X chromosome
    Species: Homo sapiens [TaxId:9606]
    Gene: RBMX, HNRPG, RBMXP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38159 (2-91)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d2mksa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mksA (A:)
    ghmveadrpgklfigglntetnekaleavfgkygrivevllmkdretnksrgfafvtfes
    padakdaardmngksldgkaikveqatkpsfe