PDB entry 2mkl

View 2mkl on RCSB PDB site
Description: Solution structure of the fourth constant immunoglobulin domain of nurse shark IgNAR
Class: immune system
Keywords: Ig domain, IgNAR, IMMUNE SYSTEM
Deposited on 2014-02-10, released 2014-07-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: novel antigen receptor
  Species: Ginglymostoma cirratum [TaxId:7801]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90544 (2-104)
    • expression tag (0-1)
  Domains in SCOPe 2.05: d2mklc_

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mklC (C:)
  mgrqtdisvsllkppfeeiwtqqtativceivysdlenikvfwqvngverkkgvetqnpe
  wsgskstivsklkvmasewdsgteyvclvedselptpvkasirka