PDB entry 2mk2

View 2mk2 on RCSB PDB site
Description: Solution NMR structure of N-terminal domain (SH2 domain) of human Inositol polyphosphate phosphatase-like protein 1 (INPPL1) (fragment 20-117), Northeast Structural Genomics Consortium Target HR9134A
Class: hydrolase
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, HYDROLASE
Deposited on 2014-01-23, released 2014-03-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: INPPL1, SHIP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15357 (11-108)
      • expression tag (0-10)
    Domains in SCOPe 2.04: d2mk2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mk2A (A:)
mghhhhhhshmswyhrdlsraaaeellaragrdgsflvrdsesvagafalcvlyqkhvht
yrilpdgedflavqtsqgvpvrrfqtlgeliglyaqpnqglvcalllpv