PDB entry 2mju

View 2mju on RCSB PDB site
Description: Solution structure of a C terminal fragment of the neuronal isoform of the polypyrimidine tract binding protein (nPTB)
Class: splicing
Keywords: nPTB, SPLICING
Deposited on 2014-01-16, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PTBP2, NPTB, PTB, PTBLP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mjua1, d2mjua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mjuA (A:)
    grvgmpgvsaggntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmad
    gnqsqlamnhlngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs
    knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
    iqalidlhnynlgenhhlrvsfsksti