PDB entry 2mjl

View 2mjl on RCSB PDB site
Description: Solution structure of peptidyl-tRNA hyrolase from Vibrio cholerae
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-01-11, released 2015-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Vibrio cholerae [TaxId:579112]
    Gene: pth, VCM66_2107
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3LPI9 (2-196)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2mjla1, d2mjla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mjlA (A:)
    mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
    elrvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
    kdtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqecldaavdesvrcleilm
    kdgltkaqnrlhtfkae