PDB entry 2mj3

View 2mj3 on RCSB PDB site
Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments and structure of Iron-sulfur cluster binding protein from Ehrlichia chaffeensis
Class: metal binding protein
Keywords: Ehrlichia chaffeensis, Iron-sulfur cluster binding protein, METAL BINDING PROTEIN
Deposited on 2013-12-23, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron-sulfur cluster binding protein
    Species: Ehrlichia chaffeensis [TaxId:205920]
    Gene: ECH_0634
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mj3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mj3A (A:)
    mplitfispdgsrktyeaydgetllslahrnnvdlegacegslacstchviidpswydiv
    eqhneisdeendmldlafgltdtsrlgcqiiltkeldglcvilptetrnisfvkns