PDB entry 2mi8

View 2mi8 on RCSB PDB site
Description: Solution structure of lysine-free (K0) ubiquitin
Class: signaling protein
Keywords: signaling protein
Deposited on 2013-12-09, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-75)
      • engineered mutation (5)
      • engineered mutation (10)
      • engineered mutation (26)
      • engineered mutation (28)
      • engineered mutation (32)
      • engineered mutation (47)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d2mi8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mi8A (A:)
mqifvrtltgrtitlevepsdtienvrariqdregippdqqrlifagrqledgrtlsdyn
iqrestlhlvlrlrgg