PDB entry 2mhs

View 2mhs on RCSB PDB site
Description: NMR Structure of human Mcl-1
Class: Apoptosis
Keywords: Mcl-1, Bcl-2 family, BH domain, Apoptosis, Cancer drug, GFT NMR
Deposited on 2013-12-04, released 2014-05-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MCL1, BCL2L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07820 (1-157)
      • initiating methionine (0)
      • engineered mutation (116)
      • expression tag (158-163)
    Domains in SCOPe 2.08: d2mhsa1, d2mhsa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhsA (A:)
    medelyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafq
    gmlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqessiep
    laesitdvlvrtkrdwlvkqrgwdgfveffhvedlegghhhhhh