PDB entry 2mha

View 2mha on RCSB PDB site
Description: crystal structure of the major histocompatibility complex class I h-2kb molecule containing a single viral peptide: implications for peptide binding and T-cell receptor recognition
Class: histocompatibility antigen
Keywords: histocompatibility antigen
Deposited on 1993-07-21, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I histocompatibility antigen (h-2kb) (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2mhaa1, d2mhaa2
  • Chain 'B':
    Compound: beta 2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2mhab_
  • Chain 'C':
    Compound: class I histocompatibility antigen (h-2kb) (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2mhac1, d2mhac2
  • Chain 'D':
    Compound: beta 2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2mhad_
  • Chain 'E':
    Compound: viral octapeptide arg-gly-tyr-val-tyr-gln-gly-leu
    Species: Vesicular stomatitis virus [TaxId:11276]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: viral octapeptide arg-gly-tyr-val-tyr-gln-gly-leu
    Species: Vesicular stomatitis virus [TaxId:11276]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaC (C:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaD (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.