PDB entry 2mh7

View 2mh7 on RCSB PDB site
Description: Solution structure of oxidized [2Fe-2S] ferredoxin PetF from Chlamydomonas reinhardtii
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-11-19, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: petF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07839 (1-94)
      • initiating methionine (0)
      • expression tag (95-100)
    Domains in SCOPe 2.07: d2mh7a1, d2mh7a2
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mh7A (A:)
    mykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
    sflddaqmgngfvltcvayptsdctiqthqeealyenlyfq