PDB entry 2mgz

View 2mgz on RCSB PDB site
Description: Solution structure of RBFOX family ASD-1 RRM and SUP-12 RRM in ternary complex with RNA
Class: RNA binding protein/RNA
Keywords: Solution Structure, Protein-RNA complex, Ternary Complex, RRM (RNA recognition motif), RNA BINDING PROTEIN-RNA complex
Deposited on 2013-11-12, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ASD-1, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: asd-1, CELE_R74.5, R74.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot G5EEW7 (1-93)
      • expression tag (0)
    Domains in SCOPe 2.07: d2mgza1, d2mgza2
  • Chain 'B':
    Compound: Protein SUP-12, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sup-12, CELE_T22B2.4, T22B2.4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O45189 (1-104)
      • expression tag (0)
    Domains in SCOPe 2.07: d2mgzb1, d2mgzb2
  • Chain 'C':
    Compound: RNA (5'-r(*up*gp*cp*ap*up*gp*gp*up*gp*up*gp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mgzA (A:)
    gdgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadra
    raefngttiegrrvevnlatqrvhnkkakplmsv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mgzB (B:)
    gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy
    gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvqla
    

  • Chain 'C':
    No sequence available.