PDB entry 2mgp

View 2mgp on RCSB PDB site
Description: Structure of Plasmodium Yoelii Merozoite Surface Protein 1 - C-terminal Domain
Class: membrane protein
Keywords: membrane protein
Deposited on 2013-11-03, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Merozoite surface protein 1
  Species: Plasmodium yoelii yoelii [TaxId:73239]
  Gene: MSP-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13828 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.07: d2mgpa1, d2mgpa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mgpA (A:)
  gvdpkhvcvdtrdipknagcfrdddgteewrcllgykkgegntcvennnptcdinnggcd
  ptascqnaestenskkiictckeptpnayyegvfcssss