PDB entry 2mgk

View 2mgk on RCSB PDB site
Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin
Class: oxygen storage
Keywords: OXYGEN STORAGE, carbon monoxide
Deposited on 1993-05-10, released 1994-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
  Domains in SCOPe 2.01: d2mgka_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mgkA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg