PDB entry 2mgi

View 2mgi on RCSB PDB site
Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin
Deposited on 1993-05-10, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2 Å
R-factor: 0.148
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2mgi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mgi_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkktgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg