PDB entry 2mec

View 2mec on RCSB PDB site
Description: changes in conformational stability of a series of mutant human lysozymes at constant positions
Class: hydrolase
Keywords: enzyme, hydrolase, o-glycosyl, alpha + beta, glycosidase
Deposited on 1998-05-02, released 1998-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (55)
    Domains in SCOPe 2.06: d2meca_
  • Chain 'B':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (55)
    Domains in SCOPe 2.06: d2mecb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mecA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygmfqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mecB (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygmfqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv