PDB entry 2meb

View 2meb on RCSB PDB site
Description: changes in conformational stability of a series of mutant human lysozymes at constant positions
Deposited on 1998-05-02, released 1998-07-15
The last revision prior to the SCOP 1.57 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2meb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2meb_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdyglfqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv