PDB entry 2mea

View 2mea on RCSB PDB site
Description:
Deposited on 1998-05-02, released 1998-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2meaa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2meab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2meaA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygffqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2meaB (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygffqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv