PDB entry 2md5

View 2md5 on RCSB PDB site
Description: Structure of uninhibited ETV6 ETS domain
Class: Transcription
Keywords: Protein, Auto-inhibition, Transcription
Deposited on 2013-08-29, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor etv6
    Species: Mus musculus [TaxId:10090]
    Gene: Etv6, Tel, Tel1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97360 (4-101)
      • expression tag (0-3)
      • engineered mutation (9)
    Domains in SCOPe 2.06: d2md5a1, d2md5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2md5A (A:)
    gshmgriadsrllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtn
    mtyekmsralrhyyklniirkepgqrllfrfmktpdeimsgr