PDB entry 2mbx

View 2mbx on RCSB PDB site
Description: Structure, dynamics and stability of allergen cod parvalbumin Gad m 1 by solution and high-pressure NMR.
Class: contractile protein
Keywords: Allergen, Parvalbumin, EF-hand, CONTRACTILE PROTEIN
Deposited on 2013-08-07, released 2014-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parvalbumin beta
    Species: Gadus morhua [TaxId:8049]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mbxa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mbxA (A:)
    mafagilndaditaalaackaegsfdhkafftkvglaakspadikkvfeiidqdksdfve
    edelklflqnfsagaralsdaetkvflkagdsdgdgkigvdefgamika