PDB entry 2mbw

View 2mbw on RCSB PDB site
Description: recombinant sperm whale myoglobin (met)
Class: oxygen transport
Keywords: heme, oxygen transport, respiratory protein
Deposited on 1996-06-20, released 1996-12-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2mbwa_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mbwA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg