PDB entry 2mb0

View 2mb0 on RCSB PDB site
Description: Solution structure of hnRNP G RRM in complex with the RNA 5'-AUCAAA-3'
Class: splicing/RNA
Keywords: hnRNP G, Splicing, RRM, SMN, SMA, SPLICING-RNA complex
Deposited on 2013-07-22, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rna_(5'-r(*ap*up*cp*ap*ap*a)-3')
  • Chain 'B':
    Compound: RNA-binding motif protein, X chromosome
    Species: Homo sapiens [TaxId:9606]
    Gene: RBMX, HNRPG, RBMXP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mb0b_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mb0B (B:)
    mveadrpgklfigglntetnekaleavfgkygrivevllmkdretnksrgfafvtfespa
    dakdaardmngksldgkaikveqatkpsfesgrrg