PDB entry 2ma9

View 2ma9 on RCSB PDB site
Description: HIV-1 Vif SOCS-box and Elongin BC solution structure
Class: viral protein/protein binding
Keywords: HIV-1 Vif SOCS-box, Elongin BC, VIRAL PROTEIN-PROTEIN BINDING complex
Deposited on 2013-07-01, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virion infectivity factor
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: vif
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ma9b_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ma9c_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ma9B (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ma9C (C:)
    vklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyft
    ykvrytnssteipefpiapeialellmaanf