PDB entry 2m9g

View 2m9g on RCSB PDB site
Description: Solution structure of calcium-bound human S100A12
Class: metal binding protein
Keywords: S100A12, calcium-bound, METAL BINDING PROTEIN
Deposited on 2013-06-07, released 2014-04-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m9ga_
  • Chain 'B':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m9gb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m9gA (A:)
    mtkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m9gB (B:)
    mtkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthke