PDB entry 2m8u

View 2m8u on RCSB PDB site
Description: Solution structure of the Dictyostelium discodieum Myosin Light Chain, MlcC
Class: contractile protein
Keywords: myosin light chain, helical bundle, CONTRACTILE PROTEIN
Deposited on 2013-05-28, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin Light Chain, MlcC
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: DDB_G0289563
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54HC2 (3-76)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d2m8ua1, d2m8ua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m8uA (A:)
    gshmnhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqn
    sgyvqyetfvgmlflwd