PDB entry 2m8s

View 2m8s on RCSB PDB site
Description: NMR Structure of the Cytoplasmic Tail of the Membrane Form of Heparin-binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-associated Athanogene 1 from Mus musculus (mBAG-1-UBH)
Class: chaperone/membrane protein
Keywords: mBAG-1, proHB-EGF-CT, CHAPERONE-MEMBRANE PROTEIN complex
Deposited on 2013-06-03, released 2014-04-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BAG family molecular chaperone regulator 1
    Species: Mus musculus [TaxId:10090]
    Gene: BAG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2m8sa_
  • Chain 'B':
    Compound: Proheparin-binding EGF-like growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HBEGF, DTR, DTS, HEGFL
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m8sA (A:)
    makteemvqteemetprlsvivthsnerydllvtpqqgnsepvvqdlaqlveeatgvplp
    fqklifkgkslkemetplsalgmqngcrvmligeksn
    

  • Chain 'B':
    No sequence available.