PDB entry 2m7v

View 2m7v on RCSB PDB site
Description: Green Light-Absorbing State of TePixJ, an Active Cyanobacteriochrome Domain
Class: signaling protein
Keywords: phytochrome, PixJ, blue/green light-absorbing, cyanobacteria, PVB, phycoviolobilin, SIGNALING PROTEIN
Deposited on 2013-05-01, released 2014-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll0569
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DLC7 (1-162)
      • expression tag (0)
      • engineered mutation (126)
      • expression tag (163-164)
    Domains in SCOPe 2.08: d2m7va1, d2m7va2, d2m7va3
  • Heterogens: PVN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m7vA (A:)
maavqlselrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardq
viedpcfrehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfg
lliahqaseprqwqeieidqfselastgslvlerlhfleqtiasl