PDB entry 2m7k

View 2m7k on RCSB PDB site
Description: NMR solution structure of N-terminal domain of (Y81F)-EhCaBP1
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2013-04-25, released 2013-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-binding protein
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m7ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m7kA (A:)
    maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
    fygsiq