PDB entry 2m6l

View 2m6l on RCSB PDB site
Description: Solution structure of the Escherichia coli holo ferric enterobactin binding protein
Class: transport protein
Keywords: periplasmic, siderophore, TRANSPORT PROTEIN
Deposited on 2013-04-05, released 2014-04-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrienterobactin-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b0592, fepB, JW0584
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2m6la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2m6lA (A:)
    mghhhhhhhhhhssghiddddkhadwprqitdsrgthtlesqpqrivstsvtltgsllai
    dapviasgattpnnrvaddqgflrqwskvakerklqrlyigepsaeavaaqmpdlilisa
    tggdsalalydqlstiaptliinyddkswqslltqlgeitghekqaaeriaqfdkqlaaa
    keqiklppqpvtaivytaaahsanlwtpesaqgqmleqlgftlaklpaglnasqsqgkrh
    diiqlggenlaaglngeslflfagdqkdadaiyanpllahlpavqnkqvyalgtetfrld
    yysamqvldrlkalf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m6lA (A:)
    adwprqitdsrgthtlesqpqrivstsvtltgsllaidapviasgattpnnrvaddqgfl
    rqwskvakerklqrlyigepsaeavaaqmpdlilisatggdsalalydqlstiaptliin
    yddkswqslltqlgeitghekqaaeriaqfdkqlaaakeqiklppqpvtaivytaaahsa
    nlwtpesaqgqmleqlgftlaklpaglnasqsqgkrhdiiqlggenlaaglngeslflfa
    gdqkdadaiyanpllahlpavqnkqvyalgtetfrldyysamqvldrlkalf