PDB entry 2m52

View 2m52 on RCSB PDB site
Description: NMR Structure of the third RNA Recognition Motif (RRM) of U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2
Class: protein binding, RNA binding protein
Keywords: RNA Recognition Motif, RNA BINDING PROTEIN, PROTEIN BINDING
Deposited on 2013-02-12, released 2013-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: Mus musculus [TaxId:10090]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m52a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m52A (A:)
    gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
    kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw