PDB entry 2m4y

View 2m4y on RCSB PDB site
Description: Rubredoxin type protein from Mycobacterium ulcerans
Class: electron transport
Keywords: rubredoxin, ELECTRON TRANSPORT, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
Deposited on 2013-02-11, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Mycobacterium ulcerans [TaxId:362242]
    Gene: rubA, MUL_2595
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2m4ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m4yA (A:)
    mtayrcpvcdytydegkgdpregfpagtrwdqipddwccpdcsvrekvdfermggk