PDB entry 2m49

View 2m49 on RCSB PDB site
Description: Structural Insights into Human S100B and Basic Fibroblast Growth Factor (FGF2) Interaction
Class: cytokine/metal binding protein
Keywords: S100B, FGF2, CYTOKINE-METAL BINDING PROTEIN complex
Deposited on 2013-02-03, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038 (0-125)
      • engineered mutation (50)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d2m49a_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2m49b_
  • Chain 'C':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038 (0-125)
      • engineered mutation (50)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d2m49c_
  • Chain 'D':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2m49d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m49A (A:)
    dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamke
    dgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
    flpmsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m49B (B:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dndgdgecdfqefmafvamvttacheffehe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m49C (C:)
    dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamke
    dgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
    flpmsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m49D (D:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dndgdgecdfqefmafvamvttacheffehe