PDB entry 2m3s

View 2m3s on RCSB PDB site
Description: Calmodulin, i85l, f92e, h107i, l112r, a128t, m144r mutant
Class: metal binding protein
Keywords: calmodulin, metal binding protein
Deposited on 2013-01-25, released 2013-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Gallus gallus [TaxId:9031]
    Gene: CALM, CAM, RCJMB04_24e7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62149 (2-150)
      • expression tag (0-1)
      • engineered mutation (87)
      • engineered mutation (94)
      • engineered mutation (109)
      • engineered mutation (114)
      • engineered mutation (130)
      • engineered mutation (146)
    Domains in SCOPe 2.06: d2m3sa1, d2m3sa2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m3sA (A:)
    slmadqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevda
    dgngtidfpefltmmarkmkdtdseeelreafrvedkdgngyisaaelrivmtnrgeklt
    deevdemiretdidgdgqvnyeefvqrmtak