PDB entry 2m3d

View 2m3d on RCSB PDB site
Description: NMR structure of the GUCT domain from human DEAD box polypeptide 21
Class: hydrolase
Keywords: GUCT domain, RRM fold, HYDROLASE
Deposited on 2013-01-16, released 2013-01-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolar RNA helicase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NR30 (1-94)
      • leader sequence (0)
    Domains in SCOPe 2.04: d2m3da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m3dA (A:)
    ghisgatsvdqrslinsnvgfvtmilqcsiempnisyawkelkeqlgeeidskvkgmvfl
    kgklgvcfdvptasvteiqekwhdsrrwqlsvate