PDB entry 2m38

View 2m38 on RCSB PDB site
Description: PTB domain of AIDA1
Class: peptide binding protein
Keywords: phosphotyrosine binding domain, peptide binding protein
Deposited on 2013-01-14, released 2013-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin repeat and sterile alpha motif domain-containing protein 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: ANKS1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z6G8
      • engineered mutation (15)
      • engineered mutation (23)
      • engineered mutation (69)
      • engineered mutation (130)
    Domains in SCOPe 2.05: d2m38a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2m38A (A:)
    stpvqawqhhpekliaqscdykaaylgsmlikelrgtestqdacakmrancqksteqmkk
    vptiilsvsakgvkfidatnkniiaeheirniscaaqdpedlstfayitkdlksnhhych
    vftafdvnlaaeiiltlgqafevayqlalqark
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m38A (A:)
    ekliaqscdykaaylgsmlikelrgtestqdacakmrancqksteqmkkvptiilsvsak
    gvkfidatnkniiaeheirniscaaqdpedlstfayitkdlksnhhychvftafdvnlaa
    eiiltlgqafevayq