PDB entry 2m2w

View 2m2w on RCSB PDB site
Description: Ternary complex of ASFV Pol X with DNA and MgdGTP
Class: transferase/DNA
Keywords: DNA polymerase, ASFV Pol X, Nucleotidyl Transferase, TRANSFERASE-DNA complex
Deposited on 2013-01-03, released 2014-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Repair DNA polymerase X
    Species: African swine fever virus [TaxId:10497]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m2wa_
  • Chain 'B':
    Compound: 5'-d(p*gp*gp*cp*gp*ap*ap*gp*cp*cp*gp*gp*gp*tp*gp*cp*gp*ap*ap*gp*cp*ap*cp*(doc))-3'
  • Heterogens: DGT, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m2wA (A:)
    mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
    llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
    syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

  • Chain 'B':
    No sequence available.