PDB entry 2m2v

View 2m2v on RCSB PDB site
Description: African Swine Fever Virus Pol X in the ternary complex with MgdGTP and DNA
Class: transferase
Keywords: DNA polymerase, Nucleotidyl Transferase, TRANSFERASE
Deposited on 2013-01-03, released 2014-04-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Repair DNA polymerase X
  Species: African swine fever virus [TaxId:10497]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42494 (0-173)
  Domains in SCOPe 2.04: d2m2va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m2vA (A:)
  mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
  llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
  syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl