PDB entry 2m2v

View 2m2v on RCSB PDB site
Description: African Swine Fever Virus Pol X in the ternary complex with MgdGTP and DNA
Class: transferase
Keywords: DNA polymerase, Nucleotidyl Transferase, TRANSFERASE
Deposited on 2013-01-03, released 2014-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Repair DNA polymerase X
    Species: African swine fever virus [TaxId:10497]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m2va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m2vA (A:)
    mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
    llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
    syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl