PDB entry 2m28

View 2m28 on RCSB PDB site
Description: NMR structure of Ca2+ bound CaBP4 C-domain
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2012-12-17, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Cabp4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m28a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2m28A (A:)
    qdaaqrtygpllnrmfgkdrelgpeeleelqaafeefdtdqdgyigyrelgdcmrtlgym
    ptemellevsqhvkmrmggfvdfeefvelispklreetahmlgvrelriafrefdkdrdg
    ritvaelrqaapallgeplegteldemlremdlngdgtidfdefvmmlstg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m28A (A:)
    hmlgvrelriafrefdkdrdgritvaelrqaapallgeplegteldemlremdlngdgti
    dfdefvmmlstg