PDB entry 2m1r

View 2m1r on RCSB PDB site
Description: PHD domain of ING4 N214D mutant
Class: gene regulation
Keywords: ing4, phd, transcription, gene regulation
Deposited on 2012-12-05, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ING4, My036
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNL4 (1-62)
      • expression tag (0)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d2m1ra1, d2m1ra2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m1rA (A:)
    mdmpvdpneptyclchqvsygemigcddpdcsiewfhfacvglttkprgkwfcprcsqer
    kkk